Inicio Productospéptidos de la hormona de crecimiento

Hormona de crecimiento larga de R3 IGF-1 que lanza el péptido

De buena calidad esteroides del culturismo para las ventas
De buena calidad esteroides del culturismo para las ventas
han cooperado con el biopro por años y a me invitaron que dijera algo aquí. ¡la mayoría del servicio profesional del embalaje, más de alta calidad y mejor!

—— Alexander Gaus

¡Biopro es impresionante!!!!! Mi representante es muy educado y me mantiene actual con nuevas promociones. ¡Sus polvos que pedí me están dando resultado muy bueno!

—— Oleg M

Usted los individuos es comunicación rápida del soooo y buena calidad. volverá definitivamente con más órdenes.

—— susan Rustiguel

Ordeno con biopro durante mucho tiempo y puedo decir que son un vendedor más apacible y más atento que usted puede hacer una orden.

—— Acebo Shane

¡La calidad es establo del sooo mientras que la orden de sus individuos estos años, él es calidad asombrosa, yo nunca cambiará mi fuente lechuga romana que me trae la buena reacción!!

—— Alex Clinton

Estoy en línea para chatear ahora

Hormona de crecimiento larga de R3 IGF-1 que lanza el péptido

China Hormona de crecimiento larga de R3 IGF-1 que lanza el péptido proveedor

Ampliación de imagen :  Hormona de crecimiento larga de R3 IGF-1 que lanza el péptido

Datos del producto:

Lugar de origen: China
Nombre de la marca: Biopro
Certificación: GMP/HACCP/ISO
Número de modelo: PEP-114

Pago y Envío Términos:

Cantidad de orden mínima: 1 cuadro
Precio: USD1~100/Box
Detalles de empaquetado: 10 frascos/caja
Tiempo de entrega: Envío inmediato
Condiciones de pago: T / T, Western Union, MoneyGram
Capacidad de la fuente: 1000 cajas por semana
Descripción detallada del producto
Nombre del producto: IGF-1 LR3 El otro nombre: R3 largo IGF-1
Nombre químico: Arg3 largo IGF-1 Abreviatura: LR3 IGF
CAS N °: 946870-92-4 Fórmula molecular: C400H625N111O115S9
Tipo de producto: Polvo de Lyophillized Paquete: 0,1 mg/vial

Péptidos IGF - 1 péptido liofilizado LR3 R3 largo IGF de la hormona de crecimiento - 1 para el levantamiento de pesas

 

  • Descripción

    IGF-1 LR3, también conocido como Long-Arginine-3-IGF-1, es un análogo de IGF-1 humano que se ha modificado para incluir una extensión del N-término del aminoácido 13 y la substitución de la arginina para el ácido glutámico en la posición 3. como resultado de estas modificaciones, IGF-1 LR3 es aproximadamente tres veces más potente que IGF-1 y posee una semivida creciente debido a la afinidad bajada para atar a Insulina-Como las proteínas Factor-Obligatorias del crecimiento (IGFBPs). IGF-1 LR3 conserva la capacidad de atar agonistically al receptor IGF-1 con estabilidad metabólica mejorada, en relación con IGF-1. La suplementación de los cultivos celulares mamíferos con R3 largo IGF-1 en una concentración mucho más baja da lugar a productividad más altamente elevada que con concentraciones estándar de insulina e IGF-1 estándar. IGF-1 LR3 puede más estimular el receptor del tipo 1 IGF e inducir así un de alto nivel de la activación de la señalización intracelular, que es responsable de promover la proliferación de célula y la inhibición del apoptosis.
     
  • Especificación

    Nombre: IGF-1 LR3
    Sinónimos: R3 largo IGF-1, LR3 IGF, IGF1 LR3, Arg3 largo IGF-1
    No. de CAS: 946870-92-4
    Fórmula molecular: C400H625N111O115S9
    Masa molecular: 9117,5 DA (g/mol)
    Secuencia de aminoácido: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA
    Estructura:
    Hormona de crecimiento larga de R3 IGF-1 que lanza el péptido
     
  • Pureza

    IGF-1 LR3 tiene un nivel de la pureza del péptido que exceda de 95,0% según lo determinado por la CLAR y el ms.

     
  • Información de aplicación

    El polipéptido R3 largo Insulina-como el Factor-Yo del crecimiento (IGF1 LR3) es un análogo del aminoácido 83 de IGF-I que comprende realmente la secuencia completa IGF-1 pero con la substitución de una arginina (Arg) para el ácido glutámico (Glu) en la posición 3, así como un péptido de la extensión del aminoácido 13. Este cambio de la secuencia hace IGF-1 LR3 evitar atar a las proteínas y permitir que tenga una semivida mucho más larga, alrededor 20-30 horas. Este análogo de IGF-1 se ha producido con el propósito del aumento de la actividad biológica del péptido de IGF.” IGF representa insulina-como factor de crecimiento. Entre los efectos el más positivos son transporte creciente del aminoácido a las células, transporte creciente de la glucosa, síntesis creciente de la proteína, y degradación disminuida de la proteína. Cuando IGF es activo se comporta diferentemente en diversos tipos de tejidos. En proteínas de las células musculares y componentes asociados de la célula se estimulan. La síntesis de la proteína se aumenta junto con la absorción del aminoácido. Como fuente de energía, IGF-1 LR3 moviliza la grasa para el uso como energía en tejido adiposo. En tejido magro, IGF-1 LR3 evita que la insulina transporte la glucosa a través de las membranas celulares. Como consecuencia las células tienen que cambiar a consumir la grasa como fuente de energía.

    IGF-1 LR3 construye el nuevo tejido del músculo promoviendo la retención del nitrógeno y la síntesis de la proteína. Esto causa el crecimiento de músculos con la hiperplasia (que es un aumento en número de las células musculares) y mitogenesis (que es el crecimiento real de las nuevas fibras de músculo). Así IGF-1 LR3 no sólo hace fibras de músculo más grandes, él hace más de ellas también. Por lo tanto, IGF puede cambiar realmente las capacidades genéticas en términos de tejido y recuento celular del músculo. IGF aumenta y distingue el número y los tipos de células presentes.

    IGF-1 LR3 es un análogo sintético del factor de crecimiento naturalmente existente de la insulina (IGF) que es un residuo del aminoácido 93. Las modificaciones de la forma natural ocurrieron con la substitución del Arg con Glu en la posición 3, dando un código R3, y también una extensión de un aminoácido 13 en el B-término. Apenas como IGF-1, R3 se ha mostrado para inducir el desarrollo y el crecimiento de células.

    Los estudios en ratones transgénicos y knockout han mostrado que puede controlar su desarrollo y crecimiento. Desempeña un papel importante como regulador en el G1 a la fase de S del ciclo celular. Cuando están aplicados a las culturas del cardiomyocyte, R3 han mostrado un aumento grande en la expresión nuclear del antígeno de la célula de la proliferación y en varios cyclins implicados en la progresión de la célula así como adentro bromodeoxyuridien (BrdU) el etiquetado (Kajstura y otros 1994). Otros efectos que tiene en variedades de células son supervivencia creciente de la célula, inhibición de los caminos apoptotic, longevidad de la cultura y recombinación creciente de la producción de la proteína (colmillo y otros 1997). En otro estudio, el uso del LR3 IGF-1 ha llevado a un aumento en la absorción de la bromodeoxiuridina del miocito por tres a cinco veces. Pero también ha mostrado que las acciones de IGF-1 LR3 han sido bloqueadas por el etiquetado de ERK y de P13K cuál totalmente suprimido la absorción de BrdU. Además, se ha mostrado el ut que en mycocytes, IGF-1 R3 estimula la división del cardiomyocyte in vivo (Sundgren y otros 2003). También se ha sugerido que IGF-1-Long 3R es más potente que el IGF-1 debido a su capacidad de enlace baja con todas las proteínas obligatorias sabidas de IGF (Tomas y otros 1995). En otra investigación, la alimentación de LR3-IGF-1 en diversas cantidades para investigar los efectos sobre el eje somatotrópico (niveles del plasma de IGF-1 y 2, IGFBPs) fue hecha. Han divulgado que el plasma Long-R3 aumentó cuando estaba administrada subcutáneo pero sin tal comportamiento cuando estaba administrada oral. Además, LR3 bajó los niveles de IGF-1 nativo adentro rbGH-inyectados en becerros, pero L-R3 aumentó las cantidades de concentraciones de IGF-II cuando estaba administrado con L-R3 subcutáneo. La administración parenteral del R3 largo IGF-1 disminuyó la concentración de la hormona de crecimiento pero no afectó al sistema secretor. También fue divulgado que los acis somatotrophic están funcionando básicamente en becerros neonatales y se pueden influenciar por la nutrición, la hormona de crecimiento y el Long-R3-IGF-1 (IGF1-LR3). (Hammon y Blum 1997).

    Tiene una semivida considerablemente más larga que la otra forma, casi 20-30 horas. Cuando IGF-1 LR3 es activo, tiene efectos múltiples sobre tejidos en células musculares. Desempeña un papel esencial en la renovación del músculo. IGF-1 LR3 anima ambos a aumentar también la distinción de células madres. IGF-1 LR3 aumenta la actividad por satélite de la célula, DNA del músculo, contenido proteínico de músculo, peso del músculo y muscle superficie transversal. La importancia de IGF-1 LR3 miente en el hecho de que todos sus efectos obvios trabajan para inducir crecimiento del músculo. Se aumentan estos efectos cuando están combinados con el entrenamiento del peso.

    La creación de la proteína es mejor junto con la absorción del aminoácido como fuente de energía. Aumenta el uso de la grasa como energía. En tejido magro, IGF-1 LR3 previene la glucosa que lleva de la forma de la insulina a través de las membranas celulares, como consecuencia, las células tienen que cambiar a consumir la grasa como fuente de energía. IGF-1 LR3 también imita la insulina en el cuerpo humano.

    Quizás también la influencia fuerte más notable que tiene en el cuerpo humano es su capacidad de causar la hiperplasia, que es el partir definido de células. La hipertrofia es qué sigue durante el entrenamiento del peso; es un aumento en el tamaño de las células musculares. Los seres humanos adultos tienen un número fijo de células musculares, de que pueden llegar a ser más grandes con el entrenamiento, no obstante el número de ventas del músculo no aumenta. Pero, con este uso de la preparación usted puede inducir la hiperplasia que aumenta realmente el número de células musculares presentes en el músculo. Los estudios de la investigación muestran que con el peso que entrena las nuevas células se convierten más rápidamente y llegan a ser más fuertes y más densas.

    IGF-1 LR3 hace a una parte importante en crecimiento de la niñez y continúa teniendo resultados en adultos. Se hace en el cuerpo humano y está en los niveles ideales durante pubertad. En la mayoría de los estudios, la longitud activa máxima para los estudios IGF-1 LR3 de la investigación es 50 días en también 20-40 días libres. La gama más común usada durante la investigación clínica está típicamente entre 20mcg a 120mcg por día.

    Durante pubertad, IGF es el más responsable del crecimiento natural del músculo que ocurre durante estos pocos años. Hay muchas diversas cosas que IGF hace en el cuerpo humano; entre los efectos el más positivos son transporte creciente del aminoácido a las células, transporte creciente de la glucosa, síntesis creciente de la proteína, degradación disminuida de la proteína y síntesis creciente del ARN.

    Quizás el efecto más interesante y más potente IGF tiene en el cuerpo humano es su capacidad de causar la hiperplasia, que es el partir real de células.

    En células musculares, se estimulan las proteínas y sus componentes de la célula. La síntesis de la proteína se aumenta junto con la absorción del aminoácido. Como fuente de energía, IGF-1 moviliza la grasa para el uso como energía en tejido adiposo. En tejido magro, IGF evita que la insulina transporte la glucosa a través de las membranas celulares. Como consecuencia, las células tienen que cambiar a consumir la grasa como fuente de energía.

    Uso de la investigación de IGF-1 LR3
    > aminoácido agrandado que transporta las células
    > producción creciente de la proteína
    > degradación reducida de la proteína
    > transporte amplificado de la glucosa
    > combinación aumentada del ARN
     
  • Compre IGF-1 LR3 (R3 largo IGF-1) de Biopro para el descuento en la primera orden.
     
  • Lista de referencia de péptidos disponibles
     
    Péptido Especificación   Péptido Especificación
    ACE-931 1 magnesio   Semorelin magnesio 2
    AOD-9604 magnesio 5   TB-500 magnesio 5
    BPC-157 magnesio 5   Tesamorelin magnesio 10
    CJC-1295 DAC magnesio 2   Triptorein magnesio 2
    CJC-1295 ningún DAC magnesio 2   Melanotan I magnesio 10
    Epithalon magnesio 10   Melanotan II magnesio 10
    FST-344 1 magnesio   PT-141 magnesio 10
    Fragmento 176-191 magnesio 5   MGF magnesio 2
    GHRP-2 magnesio 5   PEG-MGF magnesio 2
    GHRP-6 magnesio 5   Selank magnesio 5
    Gonadorelin magnesio 10   DSIP magnesio 2
    Hexarelin magnesio 2   IGF-1 LR3 0,1 magnesios
    Ipamorelin magnesio 2   IGF-1 (1-3) 1 magnesio
    Oxitocina magnesio 10   SNAP-8 magnesio 200

Contacto
Biopro Chemicals Co., Ltd.

Persona de Contactar Ahora: Mr. Johnny

Envíe su pregunta directamente a nosotros (0 / 3000)